(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE319

ALDEN1_2.PE319       Location/Qualifiers
FT   CDS             357985..358341
FT                   /locus_tag="Alide_0327"
FT                   /gene_family="HOG000219899" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04663"
FT                   /codon_start="1"
FT                   /product="phenol hydroxylase conserved region protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Phenol hydroxylase conserved region; KEGG:
FT                   rpf:Rpic12D_3551 phenol hydroxylase conserved region"
FT                   /db_xref="GI:319761057"
FT                   /db_xref="InterPro:IPR006756"
FT                   /db_xref="GeneID:10102350"
FT                   /translation="MAVTSAAPYDFPQQDTADKFPAPLLYIGWEDHKMFCAPFCVPMPP
FT                   ATRFGDMVQGALPGLYGAHPDFARIDWNRAEWFVSGKPFTPDMDKTVAENGLGHKSVIR
FT                   FRTPGLTGLQGSCF"
FT                   /protein_id="YP_004124994.1"
     MAVTSAAPYD FPQQDTADKF PAPLLYIGWE DHKMFCAPFC VPMPPATRFG DMVQGALPGL        60
     YGAHPDFARI DWNRAEWFVS GKPFTPDMDK TVAENGLGHK SVIRFRTPGL TGLQGSCF         118
//

If you have problems or comments...

PBIL Back to PBIL home page