(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE32

ALDEN1_2.PE32        Location/Qualifiers
FT   CDS             39923..41176
FT                   /locus_tag="Alide_0032"
FT                   /gene_family="HOG000290821" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /codon_start="1"
FT                   /product="nucleoside recognition domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   ajs:Ajs_0012 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="GI:319760770"
FT                   /db_xref="GO:0001882"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="GeneID:10102055"
FT                   /translation="MALNRVWTAFFLIAFATAAVRWLLGEAGIFQALLSAMFDGARAGF
FT                   EISLGLAGIMALWLGLMRVGEQAGMVELLARLAGPLLRRLFPGVPAGHPAQGAMTLNIS
FT                   ANLLGLDNAATPLGLKAMQELQTLNREPEGQASNAQIMFVVMNTAGLTLIPTSVIAIRQ
FT                   SVALKQGLGAGFNAADIFLPTLLVTFASLLAGVLSVAVAQRLPLWRARLLLPLLAVGSL
FT                   LAAAVAALSRLPAERAAQVAGTTGAAVILGVVALFLLAGAWRRVNIYDAFIDGAKEGFG
FT                   VAVQIIPYLIAILVAIGVFRAAGCMDALLAALGAGVAALGWNTDFLPALPVGLMKVLSG
FT                   AGARGLMIDVLQTHGVDSFVGRLAAIIQGSTETTFYVLAVYFGSVGVKHTRHALACALL
FT                   ADAVGLIAAIGVGYAMLR"
FT                   /protein_id="YP_004124707.1"
     MALNRVWTAF FLIAFATAAV RWLLGEAGIF QALLSAMFDG ARAGFEISLG LAGIMALWLG        60
     LMRVGEQAGM VELLARLAGP LLRRLFPGVP AGHPAQGAMT LNISANLLGL DNAATPLGLK       120
     AMQELQTLNR EPEGQASNAQ IMFVVMNTAG LTLIPTSVIA IRQSVALKQG LGAGFNAADI       180
     FLPTLLVTFA SLLAGVLSVA VAQRLPLWRA RLLLPLLAVG SLLAAAVAAL SRLPAERAAQ       240
     VAGTTGAAVI LGVVALFLLA GAWRRVNIYD AFIDGAKEGF GVAVQIIPYL IAILVAIGVF       300
     RAAGCMDALL AALGAGVAAL GWNTDFLPAL PVGLMKVLSG AGARGLMIDV LQTHGVDSFV       360
     GRLAAIIQGS TETTFYVLAV YFGSVGVKHT RHALACALLA DAVGLIAAIG VGYAMLR          417
//

If you have problems or comments...

PBIL Back to PBIL home page