(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE320

ALDEN1_2.PE320       Location/Qualifiers
FT   CDS             358412..359482
FT                   /locus_tag="Alide_0328"
FT                   /gene_family="HOG000263662" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /codon_start="1"
FT                   /product="oxidoreductase fad-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: azo:azo1850 phenol 2-monooxygenase"
FT                   /db_xref="GI:319761058"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="GeneID:10102351"
FT                   /translation="MSHQLTIEPLGQVIEVEEGQTILDAALRAGIYLPHACCHGLCGTC
FT                   KVQVTDGEVEHGEASGFALMDYERDEGLCLACCATLESDSAVIEAEIDDEPDALNLPVQ
FT                   DFAGVVSRIEDLTPTIKGVWIELDAPMTFQAGQYINLQIPGESQPRAFSIASSPAQASE
FT                   IELNIRLVPGGKGTGWVHQQLRPGERVRLSGPYGRFFVRASAHDKQGLGYLFLAGGSGL
FT                   SSPRSMVLDLLAAGGDKPITLVNGARAQDELYHHAEFLQLAAEHPRFTYVAALSGEPEG
FT                   SGWQGARGYVHEAAKAHFGNDFRGHKAYLCGPPLMIDACISTLMQGRLFERDIYTEKFI
FT                   SAADAQQVRSPLFKKI"
FT                   /protein_id="YP_004124995.1"
     MSHQLTIEPL GQVIEVEEGQ TILDAALRAG IYLPHACCHG LCGTCKVQVT DGEVEHGEAS        60
     GFALMDYERD EGLCLACCAT LESDSAVIEA EIDDEPDALN LPVQDFAGVV SRIEDLTPTI       120
     KGVWIELDAP MTFQAGQYIN LQIPGESQPR AFSIASSPAQ ASEIELNIRL VPGGKGTGWV       180
     HQQLRPGERV RLSGPYGRFF VRASAHDKQG LGYLFLAGGS GLSSPRSMVL DLLAAGGDKP       240
     ITLVNGARAQ DELYHHAEFL QLAAEHPRFT YVAALSGEPE GSGWQGARGY VHEAAKAHFG       300
     NDFRGHKAYL CGPPLMIDAC ISTLMQGRLF ERDIYTEKFI SAADAQQVRS PLFKKI           356
//

If you have problems or comments...

PBIL Back to PBIL home page