(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE321

ALDEN1_2.PE321       Location/Qualifiers
FT   CDS             359496..359837
FT                   /locus_tag="Alide_0329"
FT                   /gene_family="HOG000219890" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /codon_start="1"
FT                   /product="ferredoxin"
FT                   /transl_table="11"
FT                   /note="PFAM: ferredoxin; KEGG: ajs:Ajs_0217 ferredoxin"
FT                   /db_xref="GI:319761059"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="GeneID:10102352"
FT                   /translation="MASYTITIAETGESYRCLDERSVLEGMEALGRKGIPVGCRQGGCG
FT                   VCKVQVLEGRYAKRVMSRAHVSAEEEASGCVLSCRIKPSSDLRVSVVGAMKKNVCRPQE
FT                   QAAPTLSTP"
FT                   /protein_id="YP_004124996.1"
     MASYTITIAE TGESYRCLDE RSVLEGMEAL GRKGIPVGCR QGGCGVCKVQ VLEGRYAKRV        60
     MSRAHVSAEE EASGCVLSCR IKPSSDLRVS VVGAMKKNVC RPQEQAAPTL STP              113
//

If you have problems or comments...

PBIL Back to PBIL home page