(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE323

ALDEN1_2.PE323       Location/Qualifiers
FT   CDS             360786..361217
FT                   /locus_tag="Alide_0331"
FT                   /gene_family="HOG000195938" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   ajs:Ajs_0219 hypothetical protein"
FT                   /db_xref="GI:319761061"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="GeneID:10102354"
FT                   /translation="MQRSVEQRAITAEAAHAAVAAACAKAGELGIRVNAAVTDASGVLA
FT                   AFLRMPGAFLHSVDIAIDKAYTAAGFGFATAQWVGILRGDEALRLGMPQRPRNVVFGGG
FT                   LPMREGGVLIGGIGVSGGSAEQDEICARAALAALGLEET"
FT                   /protein_id="YP_004124998.1"
     MQRSVEQRAI TAEAAHAAVA AACAKAGELG IRVNAAVTDA SGVLAAFLRM PGAFLHSVDI        60
     AIDKAYTAAG FGFATAQWVG ILRGDEALRL GMPQRPRNVV FGGGLPMREG GVLIGGIGVS       120
     GGSAEQDEIC ARAALAALGL EET                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page