(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE324

ALDEN1_2.PE324       Location/Qualifiers
FT   CDS             362556..363461
FT                   /locus_tag="Alide_0334"
FT                   /gene_family="HOG000116922" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_3154"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_3154 ZorfX"
FT                   /db_xref="GI:319761062"
FT                   /db_xref="GeneID:10102357"
FT                   /translation="MKTTSIAAAAAAAAAAALALLAATGAHADGHYVPGVEGIQAASVP
FT                   PPGMYYLGYLVNYNIDDFRAPGSSTNLPGHNSGTVTALANRFVWITGHKLLGADYGVEA
FT                   IVPLVRTSLTINAAGISDSRSGVGDIYLGPLVLGWHGPQWDAVAAAGMWFDTASTSHPA
FT                   SAGKGFKSTMLTGGLTYYFDGAKTLSGSALMRYEFNGRNSAGVRPGDQLTLEWGLGKSF
FT                   GAVSAGLVGYSQWQTTNDDGAGASTNKAARHAVGAELVYPVPGAGVFLKGAVYKEFSAT
FT                   AGTGPQPKGSLVRFTLVKAF"
FT                   /protein_id="YP_004124999.1"
     MKTTSIAAAA AAAAAAALAL LAATGAHADG HYVPGVEGIQ AASVPPPGMY YLGYLVNYNI        60
     DDFRAPGSST NLPGHNSGTV TALANRFVWI TGHKLLGADY GVEAIVPLVR TSLTINAAGI       120
     SDSRSGVGDI YLGPLVLGWH GPQWDAVAAA GMWFDTASTS HPASAGKGFK STMLTGGLTY       180
     YFDGAKTLSG SALMRYEFNG RNSAGVRPGD QLTLEWGLGK SFGAVSAGLV GYSQWQTTND       240
     DGAGASTNKA ARHAVGAELV YPVPGAGVFL KGAVYKEFSA TAGTGPQPKG SLVRFTLVKA       300
     F                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page