(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE325

ALDEN1_2.PE325       Location/Qualifiers
FT   CDS             364232..365692
FT                   /locus_tag="Alide_0335"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03216"
FT                   /codon_start="1"
FT                   /product="2-hydroxymuconic semialdehyde dehydrogenase"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0220 betaine-aldehyde dehydrogenase;
FT                   TIGRFAM: 2-hydroxymuconic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="GI:319761063"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR017628"
FT                   /db_xref="GeneID:10102358"
FT                   /translation="MKEFLNFINGEYVRGTSGKTFDDINPVDGSLIGRIHEAGQGEVNA
FT                   AVAAAQAALKGDWGRLAVVERCKLLDAVAGEINRRFDDFLQAEIADTGKPHHLASHVDI
FT                   PRGAANFQIFIDTIKSTATESFNMRTPDGKTALSYGVRVPRGVIAVVCPWNLPLLLMTW
FT                   KVGPALACGNTVVVKPSEETPATATLLGEVMNAVGMPKGVYNVVHGFGPGSAGEFLTRH
FT                   PGVNGITFTGETRTGSAIMKAAADGVRPVSLEMGGKNAAVVFADCDFQVAVDTLTRSCF
FT                   ENAGQVCLGTERVYVERPIFEKLVAALKERAEAMKPGLPFDKDTKIGPLISKKHQAKVL
FT                   GLYQKAKDEGATIVTGGGIPDMPEALRGGSWVQPTIWTGLPETATVVTEEIFGPCCHIS
FT                   PFDTEEEVLGKVNANRYGLATAVFTQDIARANRLAHQIEVGLCWINAWFLRDLRTPFGG
FT                   SKQSGIGREGGVHSLEFYTELRNVMVKF"
FT                   /protein_id="YP_004125000.1"
     MKEFLNFING EYVRGTSGKT FDDINPVDGS LIGRIHEAGQ GEVNAAVAAA QAALKGDWGR        60
     LAVVERCKLL DAVAGEINRR FDDFLQAEIA DTGKPHHLAS HVDIPRGAAN FQIFIDTIKS       120
     TATESFNMRT PDGKTALSYG VRVPRGVIAV VCPWNLPLLL MTWKVGPALA CGNTVVVKPS       180
     EETPATATLL GEVMNAVGMP KGVYNVVHGF GPGSAGEFLT RHPGVNGITF TGETRTGSAI       240
     MKAAADGVRP VSLEMGGKNA AVVFADCDFQ VAVDTLTRSC FENAGQVCLG TERVYVERPI       300
     FEKLVAALKE RAEAMKPGLP FDKDTKIGPL ISKKHQAKVL GLYQKAKDEG ATIVTGGGIP       360
     DMPEALRGGS WVQPTIWTGL PETATVVTEE IFGPCCHISP FDTEEEVLGK VNANRYGLAT       420
     AVFTQDIARA NRLAHQIEVG LCWINAWFLR DLRTPFGGSK QSGIGREGGV HSLEFYTELR       480
     NVMVKF                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page