(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE33

ALDEN1_2.PE33        Location/Qualifiers
FT   CDS             41657..41908
FT                   /locus_tag="Alide_0033"
FT                   /gene_family="HOG000280481" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0031"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0031 hypothetical protein"
FT                   /db_xref="GI:319760771"
FT                   /db_xref="GeneID:10102056"
FT                   /translation="MTDSALIPLPDHLAVDPRSPHHVAAVFQQQADIGIRFNGKERFDV
FT                   EEYCVSEGWIKVPAGKTLDRRGRPLLITLKGSVEAFYK"
FT                   /protein_id="YP_004124708.1"
     MTDSALIPLP DHLAVDPRSP HHVAAVFQQQ ADIGIRFNGK ERFDVEEYCV SEGWIKVPAG        60
     KTLDRRGRPL LITLKGSVEA FYK                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page