(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE330

ALDEN1_2.PE330       Location/Qualifiers
FT   CDS             369423..370211
FT                   /locus_tag="Alide_0340"
FT                   /gene_family="HOG000179637" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03218"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.77"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 4-oxalocrotonate decarboxylase; KEGG:
FT                   ajs:Ajs_0225 4-oxalocrotonate decarboxylase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="GI:319761068"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR017630"
FT                   /db_xref="GeneID:10102363"
FT                   /translation="MALNQATIAQLAEHLENCQLQVRDTPKITDEHPGMDWDDAYAIQD
FT                   AILQRKLARGARVVGLKAGLTSHAKMKQMGVESPVFGFLVDDYCVPEGGTVQTRELIHP
FT                   KVEPEIVFVLKHALKGPGCHIGAVLAATDFVLPGIEVIDSRYRDFKFDLKSVVADNTSA
FT                   ARFVVGGQAQRPERVDLRTCGIVLEKNGQPVALGAGAAVLGHPAAAIAMLANHLGRRGQ
FT                   ELPAGSMILSGGVTEAVSVQAGDNVSLRVQGMGSVSLRFA"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /protein_id="YP_004125005.1"
     MALNQATIAQ LAEHLENCQL QVRDTPKITD EHPGMDWDDA YAIQDAILQR KLARGARVVG        60
     LKAGLTSHAK MKQMGVESPV FGFLVDDYCV PEGGTVQTRE LIHPKVEPEI VFVLKHALKG       120
     PGCHIGAVLA ATDFVLPGIE VIDSRYRDFK FDLKSVVADN TSAARFVVGG QAQRPERVDL       180
     RTCGIVLEKN GQPVALGAGA AVLGHPAAAI AMLANHLGRR GQELPAGSMI LSGGVTEAVS       240
     VQAGDNVSLR VQGMGSVSLR FA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page