(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE331

ALDEN1_2.PE331       Location/Qualifiers
FT   CDS             370252..371220
FT                   /locus_tag="Alide_0341"
FT                   /gene_family="HOG000126603" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_3145"
FT                   /codon_start="1"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /transl_table="11"
FT                   /note="KEGG: ctt:CtCNB1_3145 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="GI:319761069"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="GeneID:10102364"
FT                   /translation="MQRRDFMAAAALAGLAPAWAQAGYPAKPVRMIVPFPPGGPTDVMG
FT                   RTAAKAMGDRLGQQFVVENKAGAGGNIGTDAVAKAAPDGYTIGLTAISSLAIAPHLYSS
FT                   VPFNVEKDFVPISLVGTTPCALVIHPAAPFSDLKGMVAYAKANPGKLSYATSGIGTSNH
FT                   LAAELLQSVAGIQLTGVPYKGSSQIVPDLLSGTVMMSMESSLATTLQHVRAGKLKAIAV
FT                   TSPQRAKALPDVPTVAESGYPGFEVETWFGLVAPARTPQAVVDKLHDAWAAGSAAPEAR
FT                   AAFDNISGNLRVTTPQQFAEFIRAENRRWGDLIRKLGIKAD"
FT                   /protein_id="YP_004125006.1"
     MQRRDFMAAA ALAGLAPAWA QAGYPAKPVR MIVPFPPGGP TDVMGRTAAK AMGDRLGQQF        60
     VVENKAGAGG NIGTDAVAKA APDGYTIGLT AISSLAIAPH LYSSVPFNVE KDFVPISLVG       120
     TTPCALVIHP AAPFSDLKGM VAYAKANPGK LSYATSGIGT SNHLAAELLQ SVAGIQLTGV       180
     PYKGSSQIVP DLLSGTVMMS MESSLATTLQ HVRAGKLKAI AVTSPQRAKA LPDVPTVAES       240
     GYPGFEVETW FGLVAPARTP QAVVDKLHDA WAAGSAAPEA RAAFDNISGN LRVTTPQQFA       300
     EFIRAENRRW GDLIRKLGIK AD                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page