(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE334

ALDEN1_2.PE334       Location/Qualifiers
FT   CDS             complement(372207..372959)
FT                   /locus_tag="Alide_0344"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /codon_start="1"
FT                   /product="regulatory protein iclr"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4281 IclR family transcriptional
FT                   regulator; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:319761072"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:10102367"
FT                   /translation="MSNPPAPSKPADGGVIAVTRALQLLEAFAVGESHLSLAELSRRAG
FT                   LHKTTVLRLARTLAQSGYMVQREDGDWRLGPAAGWLGARYQAGFDVQNVLEPALRELTQ
FT                   TSGESAAFYVREGNVRTCLVRVEGPQALRHHARMGEGLPLDKGSPGRVILAFSGEPGEV
FT                   YEEIRRRGYHWSIGEREQGVATVSAPVFGRNWRLLGCVCISGPQSRLPQEKLEALAQTI
FT                   IKTANQLSYALAGKAASTAAQVPGVWHP"
FT                   /protein_id="YP_004125009.1"
     MSNPPAPSKP ADGGVIAVTR ALQLLEAFAV GESHLSLAEL SRRAGLHKTT VLRLARTLAQ        60
     SGYMVQREDG DWRLGPAAGW LGARYQAGFD VQNVLEPALR ELTQTSGESA AFYVREGNVR       120
     TCLVRVEGPQ ALRHHARMGE GLPLDKGSPG RVILAFSGEP GEVYEEIRRR GYHWSIGERE       180
     QGVATVSAPV FGRNWRLLGC VCISGPQSRL PQEKLEALAQ TIIKTANQLS YALAGKAAST       240
     AAQVPGVWHP                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page