(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE335

ALDEN1_2.PE335       Location/Qualifiers
FT   CDS             373084..374064
FT                   /locus_tag="Alide_0345"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_4280"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4280 hypothetical protein"
FT                   /db_xref="GI:319761073"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102368"
FT                   /translation="MLARTLSRSLCAAALGLAAATGALAQAAYPAKPIRLIVPFPPGGG
FT                   TDMIARTVAQKVADQNKWSVIVDNRPGAGGNLGVDAAAKAAPDGYTLVMGQTSNLAINP
FT                   TLYPRLPYDPLKDLVPVALVSSSPIVMAAPANTPFKTFADVVAAAKKQPDGITLGYSGN
FT                   GTVAHLAGELAENAAGIKLRHIPYKGAAQAMTDLVSGQIDLYMSSVPTLLGQVRNGKLR
FT                   PIVVTSLKRSAQLPDTPSLAESGYRGFDAVTWFGVLAPAGTPASIVQQLNKAINEALKQ
FT                   PEVAEKLRSEGGDVLGGTPEQFDQLLRAEVPRWGKIVKDSGASLD"
FT                   /protein_id="YP_004125010.1"
     MLARTLSRSL CAAALGLAAA TGALAQAAYP AKPIRLIVPF PPGGGTDMIA RTVAQKVADQ        60
     NKWSVIVDNR PGAGGNLGVD AAAKAAPDGY TLVMGQTSNL AINPTLYPRL PYDPLKDLVP       120
     VALVSSSPIV MAAPANTPFK TFADVVAAAK KQPDGITLGY SGNGTVAHLA GELAENAAGI       180
     KLRHIPYKGA AQAMTDLVSG QIDLYMSSVP TLLGQVRNGK LRPIVVTSLK RSAQLPDTPS       240
     LAESGYRGFD AVTWFGVLAP AGTPASIVQQ LNKAINEALK QPEVAEKLRS EGGDVLGGTP       300
     EQFDQLLRAE VPRWGKIVKD SGASLD                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page