(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE337

ALDEN1_2.PE337       Location/Qualifiers
FT   CDS             374967..375956
FT                   /locus_tag="Alide_0347"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_4278"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4278 hypothetical protein"
FT                   /db_xref="GI:319761075"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102370"
FT                   /translation="MSAHDFSATRRRLLATLGVALAAGPALAQEWPGGKTITYVVPYPP
FT                   GGSTDVLGRNIAQRLGPALGTTVIVDNKPGATGTIGAAFVARAQPDGYTLLGTTIGPQA
FT                   IAPHLMGKLPYDPIAGFEPVITLGTIPHILVVGAGQPFQGVADLVAAGKAQPGKLAYAS
FT                   GGNGTILQMQAELLQQQTGARFIHVPYKGDTPALQDTLGGQVQFMFAPAAAALPHVQAG
FT                   KLRALAVTSAQRLPALPQVPTMGEAGLKDFVVEQWHAVFVPARTPAAIVQRLNAEIAKA
FT                   LKDPAVTALADKLGITLVGGTPGQLAALQKADSTKWAKVIRDGNIKAD"
FT                   /protein_id="YP_004125012.1"
     MSAHDFSATR RRLLATLGVA LAAGPALAQE WPGGKTITYV VPYPPGGSTD VLGRNIAQRL        60
     GPALGTTVIV DNKPGATGTI GAAFVARAQP DGYTLLGTTI GPQAIAPHLM GKLPYDPIAG       120
     FEPVITLGTI PHILVVGAGQ PFQGVADLVA AGKAQPGKLA YASGGNGTIL QMQAELLQQQ       180
     TGARFIHVPY KGDTPALQDT LGGQVQFMFA PAAAALPHVQ AGKLRALAVT SAQRLPALPQ       240
     VPTMGEAGLK DFVVEQWHAV FVPARTPAAI VQRLNAEIAK ALKDPAVTAL ADKLGITLVG       300
     GTPGQLAALQ KADSTKWAKV IRDGNIKAD                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page