(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE338

ALDEN1_2.PE338       Location/Qualifiers
FT   CDS             375989..376675
FT                   /locus_tag="Alide_0348"
FT                   /gene_family="HOG000107599" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /codon_start="1"
FT                   /product="dimethylmenaquinone methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   dac:Daci_4277 dimethylmenaquinone methyltransferase"
FT                   /db_xref="GI:319761076"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="GeneID:10102371"
FT                   /translation="MSQLPEVIRSFERVSAEVVQQAGTFQAAILADVAGRRGTLHARVA
FT                   PVHERMKLAGPAFTVEVRPGDNLMIHAAIALAQPGDILVIDGKGDQTAALMGTLMLSAC
FT                   KKRGLGGVIVDGAIRDKLELLELGFPVFSAGFNPAGPTKFVPGRINHPISCAGASVFPG
FT                   DLVVGDADGVVVIERAKAPAMMALAVKKVADEAARIEAIARGDTASKWLPAALRAAGVL
FT                   KEGEEL"
FT                   /protein_id="YP_004125013.1"
     MSQLPEVIRS FERVSAEVVQ QAGTFQAAIL ADVAGRRGTL HARVAPVHER MKLAGPAFTV        60
     EVRPGDNLMI HAAIALAQPG DILVIDGKGD QTAALMGTLM LSACKKRGLG GVIVDGAIRD       120
     KLELLELGFP VFSAGFNPAG PTKFVPGRIN HPISCAGASV FPGDLVVGDA DGVVVIERAK       180
     APAMMALAVK KVADEAARIE AIARGDTASK WLPAALRAAG VLKEGEEL                    228
//

If you have problems or comments...

PBIL Back to PBIL home page