(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE34

ALDEN1_2.PE34        Location/Qualifiers
FT   CDS             complement(41877..43754)
FT                   /locus_tag="Alide_0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Balat_0053"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: blt:Balat_0053 beta-galactosidase I"
FT                   /db_xref="GI:319760772"
FT                   /db_xref="GeneID:10102057"
FT                   /translation="MNFLLRSAAALLCSLFVGGAATAKPQVATLIVMPQDLRQNPQIVS
FT                   DLQRRGINHATVYLTWADVEAQPGHFDFSAYDPYFDQLTQGGLSLVVVLDMGGRAYFDG
FT                   TGKHFPGRTTVPEWLYRQVPDGFMKNFSGQSTPQPDFMNPTVRQFSAQFVRNAVAHLSQ
FT                   RYPGKVTAYSIGLQEEHEIKYGQTGYQWRDYADAAQAAFRQQTGAPLPVINYTSDIALG
FT                   LPRTEPLLHAHKQFREANLKEATCFYADAIRSQGGRAMSYFGELFTAHDGIYATSVAEQ
FT                   LADCLDIAVIDYNFYDGYSLSPDARVLPMLANYMASVGYKQIMVGAYAEQWERVKKSTE
FT                   LLPVISRTLSTALAQPNVIGYEVGGLQRQLDTHLTGTVDLDKLQALRVQPPVPATASTG
FT                   KKLTVGILASTSNYYVWHGDRSGGVNVHREALLEAYNLLSTQPGFDVHVIGEKNLQEDD
FT                   LLQRLNAIVVPHQAALPASIKQQLKVYWKKGGTLVQDMRLGEFDENGKPVYDWMHEVFG
FT                   IENITWRPRGGIFLTDDGQILRLKPARKLYTGYAAMTPRPGYRLLATDILNKRQGIMVR
FT                   GERTLVFGFTPQLVEDATQAMWQQIFVREIANAVRCPTPTTCKTPPRSP"
FT                   /protein_id="YP_004124709.1"
     MNFLLRSAAA LLCSLFVGGA ATAKPQVATL IVMPQDLRQN PQIVSDLQRR GINHATVYLT        60
     WADVEAQPGH FDFSAYDPYF DQLTQGGLSL VVVLDMGGRA YFDGTGKHFP GRTTVPEWLY       120
     RQVPDGFMKN FSGQSTPQPD FMNPTVRQFS AQFVRNAVAH LSQRYPGKVT AYSIGLQEEH       180
     EIKYGQTGYQ WRDYADAAQA AFRQQTGAPL PVINYTSDIA LGLPRTEPLL HAHKQFREAN       240
     LKEATCFYAD AIRSQGGRAM SYFGELFTAH DGIYATSVAE QLADCLDIAV IDYNFYDGYS       300
     LSPDARVLPM LANYMASVGY KQIMVGAYAE QWERVKKSTE LLPVISRTLS TALAQPNVIG       360
     YEVGGLQRQL DTHLTGTVDL DKLQALRVQP PVPATASTGK KLTVGILAST SNYYVWHGDR       420
     SGGVNVHREA LLEAYNLLST QPGFDVHVIG EKNLQEDDLL QRLNAIVVPH QAALPASIKQ       480
     QLKVYWKKGG TLVQDMRLGE FDENGKPVYD WMHEVFGIEN ITWRPRGGIF LTDDGQILRL       540
     KPARKLYTGY AAMTPRPGYR LLATDILNKR QGIMVRGERT LVFGFTPQLV EDATQAMWQQ       600
     IFVREIANAV RCPTPTTCKT PPRSP                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page