(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE341

ALDEN1_2.PE341       Location/Qualifiers
FT   CDS             378950..379906
FT                   /locus_tag="Alide_0351"
FT                   /gene_family="HOG000126604" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_4274"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_4274 hypothetical protein"
FT                   /db_xref="GI:319761079"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="GeneID:10102374"
FT                   /translation="MKSLKKYLLAACACIALAAHAAFPERPITIVVPYAPGGAADAVAR
FT                   VIASRLGTRLGGSVIVDNKAGASGTIGAGYVAKAQADGYTMLYDATPYSINPHLFPKMP
FT                   YAANALQPLSLVLLAPNVLIVPASAPFKSVGDLIAKAKAEPGKLNFASGGSGTVQRLAA
FT                   ELFRQKLGLDMVHVPYKSGGPAITDVMAGQVDFMFGTVAATAPHIAAGKLRALAVSSPE
FT                   RSRRLPDVPTVAEAAIPGYEAYEWNGMFLPAGTPAPIAAQLHKALAEVLQEDEVRQRLA
FT                   DMGAQPIGSTPAEFAAFLKKEDAKWGEVVRKGHIKLD"
FT                   /protein_id="YP_004125016.1"
     MKSLKKYLLA ACACIALAAH AAFPERPITI VVPYAPGGAA DAVARVIASR LGTRLGGSVI        60
     VDNKAGASGT IGAGYVAKAQ ADGYTMLYDA TPYSINPHLF PKMPYAANAL QPLSLVLLAP       120
     NVLIVPASAP FKSVGDLIAK AKAEPGKLNF ASGGSGTVQR LAAELFRQKL GLDMVHVPYK       180
     SGGPAITDVM AGQVDFMFGT VAATAPHIAA GKLRALAVSS PERSRRLPDV PTVAEAAIPG       240
     YEAYEWNGMF LPAGTPAPIA AQLHKALAEV LQEDEVRQRL ADMGAQPIGS TPAEFAAFLK       300
     KEDAKWGEVV RKGHIKLD                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page