(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE342

ALDEN1_2.PE342       Location/Qualifiers
FT   CDS             379912..380787
FT                   /locus_tag="Alide_0352"
FT                   /gene_family="HOG000107488" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: dac:Daci_4273
FT                   amidohydrolase 2"
FT                   /db_xref="GI:319761080"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:10102375"
FT                   /translation="MAQPLLSAPVPHSVGLNRPARTLPPLACDSHMHIFDPRFAPSPHW
FT                   RRQPPDAPVAAYRQLQQRLGTRRAVVVTPSTYGTGNACTLDALDQLGDDARGVAVVAQD
FT                   VQDAELDRLHARRVRGLRVNFVSPQSWGETTPQMLATLARKAARLPGWHIQVFMHPEQI
FT                   VALESVLAALPVPLVVDHLGRIDPAQGQRAEAHGALRRLLDGGNAWVKLSGAYMRSTAP
FT                   AYADTLPLAQALVRAAPERLVWGSDWPHTTEAPGTVNDAGLVDLLRAWAGSDAAMDRIL
FT                   VDNPARLYGF"
FT                   /protein_id="YP_004125017.1"
     MAQPLLSAPV PHSVGLNRPA RTLPPLACDS HMHIFDPRFA PSPHWRRQPP DAPVAAYRQL        60
     QQRLGTRRAV VVTPSTYGTG NACTLDALDQ LGDDARGVAV VAQDVQDAEL DRLHARRVRG       120
     LRVNFVSPQS WGETTPQMLA TLARKAARLP GWHIQVFMHP EQIVALESVL AALPVPLVVD       180
     HLGRIDPAQG QRAEAHGALR RLLDGGNAWV KLSGAYMRST APAYADTLPL AQALVRAAPE       240
     RLVWGSDWPH TTEAPGTVND AGLVDLLRAW AGSDAAMDRI LVDNPARLYG F                291
//

If you have problems or comments...

PBIL Back to PBIL home page