(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE343

ALDEN1_2.PE343       Location/Qualifiers
FT   CDS             380800..381717
FT                   /locus_tag="Alide_0353"
FT                   /gene_family="HOG000219379" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /codon_start="1"
FT                   /product="smp-30/gluconolaconase/lre-like region-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE-like
FT                   region-containing protein; KEGG: dac:Daci_4272
FT                   SMP-30/gluconolaconase/LRE domain-containing protein"
FT                   /db_xref="GI:319761081"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="GeneID:10102376"
FT                   /translation="MFLLQAPEVRELELFTSMPEPLRRRQRSAWADANRGGAVTDSFLE
FT                   GPVFDDAGNLYVTDIPWGRILRIDAQGAWTLVAEYDGEPNGMKFLDAGTLLITDYKNGL
FT                   MRLDVASGKVTPYLERRNSERFKGVNDLVFDSAGNLYFTDQGQSGLHDPSGRLYRLRPS
FT                   GQLDLLLANVPSPNGVALSPDERVLYLAATRGNCVWRVPLLPDGSVAKVGQFFTSYGPS
FT                   GPDGLAVDAEGRVLVANPGLGYVWVLNGRAEPVLVLRGAPGSSTTNLAFGGEGRRQLYV
FT                   TDSTHGRILRAALDAPGLALHRPR"
FT                   /protein_id="YP_004125018.1"
     MFLLQAPEVR ELELFTSMPE PLRRRQRSAW ADANRGGAVT DSFLEGPVFD DAGNLYVTDI        60
     PWGRILRIDA QGAWTLVAEY DGEPNGMKFL DAGTLLITDY KNGLMRLDVA SGKVTPYLER       120
     RNSERFKGVN DLVFDSAGNL YFTDQGQSGL HDPSGRLYRL RPSGQLDLLL ANVPSPNGVA       180
     LSPDERVLYL AATRGNCVWR VPLLPDGSVA KVGQFFTSYG PSGPDGLAVD AEGRVLVANP       240
     GLGYVWVLNG RAEPVLVLRG APGSSTTNLA FGGEGRRQLY VTDSTHGRIL RAALDAPGLA       300
     LHRPR                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page