(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE350

ALDEN1_2.PE350       Location/Qualifiers
FT   CDS             387622..388776
FT                   /locus_tag="Alide_0360"
FT                   /gene_family="HOG000128115" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /codon_start="1"
FT                   /product="extracellular ligand-binding receptor"
FT                   /transl_table="11"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bav:BAV0983 ABC transporter, substrate-binding protein"
FT                   /db_xref="GI:319761088"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="GeneID:10102383"
FT                   /translation="MKKILAASLLCVGCGAFAQEELKIGAIVTLSGAGAAWGQAMLYAA
FT                   ELAADDVNAKGGLDVGGRKYKVKVVAYDDKYQAGEAVTAANRLVFEDKVKYVIGPVGSA
FT                   AALAVGPIMEKNKVVMLTLGFTDKALAADKPFSFRPNLTTMETSQPQIDWIVKAKNIKK
FT                   VGALFPNDETGQQIAQDLEKAYAKAGAQMNAKEFFERERVDMMPLLTRIMAKGVDAIEL
FT                   DGNAPGTAGLIVKQARELGFKGHIIRSGGPATAEIVNVAGTGATNGMLVNTPINPANAE
FT                   VKAYAERYFGKYKKRMNGFSPAFYDGTRMLFQAMGQAGTATDTDKVRVALEGIKDFKGI
FT                   LGTLNWTGKEVYGSNHQISAPFYVARVQDGQEVVESTCSLSACK"
FT                   /protein_id="YP_004125025.1"
     MKKILAASLL CVGCGAFAQE ELKIGAIVTL SGAGAAWGQA MLYAAELAAD DVNAKGGLDV        60
     GGRKYKVKVV AYDDKYQAGE AVTAANRLVF EDKVKYVIGP VGSAAALAVG PIMEKNKVVM       120
     LTLGFTDKAL AADKPFSFRP NLTTMETSQP QIDWIVKAKN IKKVGALFPN DETGQQIAQD       180
     LEKAYAKAGA QMNAKEFFER ERVDMMPLLT RIMAKGVDAI ELDGNAPGTA GLIVKQAREL       240
     GFKGHIIRSG GPATAEIVNV AGTGATNGML VNTPINPANA EVKAYAERYF GKYKKRMNGF       300
     SPAFYDGTRM LFQAMGQAGT ATDTDKVRVA LEGIKDFKGI LGTLNWTGKE VYGSNHQISA       360
     PFYVARVQDG QEVVESTCSL SACK                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page