(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE352

ALDEN1_2.PE352       Location/Qualifiers
FT   CDS             389672..390670
FT                   /locus_tag="Alide_0362"
FT                   /gene_family="HOG000202417" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dma:DMR_11370 ABC transporter permease protein"
FT                   /db_xref="GI:319761090"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:10102385"
FT                   /translation="MHASSSISTMKPRAPDSGAGAPQARWRLWLPGLLVLFALPLFTSS
FT                   PFHMHLAVLICLNIIFVNGLSLLSRTGQLSFCHAAFMGMGAYASVIATTQWHVPFLLSV
FT                   ALGVAVAAAVAFLLGAVILRLQGVYFVLVTFCFGELFRLFLLEGGSYTGGANGIANIPP
FT                   ASILGLAFDTKTSFYVLAAACAFASIALLIALFRTPQGTALDAVGDNQELAEASGIGIQ
FT                   RTQMFAFVLGSAMAGFAGALLAHYLGFVSPESFNQHISVAAIVMLVIGGRASVLGPILG
FT                   ALIMTPLPELFRSAIETQNILYGITLILVLKFLPGGLVGIAAKLRGKGGKA"
FT                   /protein_id="YP_004125027.1"
     MHASSSISTM KPRAPDSGAG APQARWRLWL PGLLVLFALP LFTSSPFHMH LAVLICLNII        60
     FVNGLSLLSR TGQLSFCHAA FMGMGAYASV IATTQWHVPF LLSVALGVAV AAAVAFLLGA       120
     VILRLQGVYF VLVTFCFGEL FRLFLLEGGS YTGGANGIAN IPPASILGLA FDTKTSFYVL       180
     AAACAFASIA LLIALFRTPQ GTALDAVGDN QELAEASGIG IQRTQMFAFV LGSAMAGFAG       240
     ALLAHYLGFV SPESFNQHIS VAAIVMLVIG GRASVLGPIL GALIMTPLPE LFRSAIETQN       300
     ILYGITLILV LKFLPGGLVG IAAKLRGKGG KA                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page