(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE353

ALDEN1_2.PE353       Location/Qualifiers
FT   CDS             390667..391446
FT                   /locus_tag="Alide_0363"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="abc transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pth:PTH_2348 ABC-type branched-chain amino
FT                   acid transport systems, ATPase component; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:319761091"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:10102386"
FT                   /translation="MTALLKVDGLSRYFGGLAAVKDLSFELNAGEIVGLIGPNGAGKST
FT                   AFNVISGSLAPSAGRIQFAGQSIEGMRPSQVVRHGLARTFQSATVYPAATVQENLYRGA
FT                   LARFDVPVWAQIAQTASYRSALRKVREEVDEVLEITGLAPYRDDVAGALAYGHQKRIGV
FT                   AIGLATRPRLLLLDEPAAGLNPEECAEFGCLLKTLRDRHEISLLFVEHHMALVMNTCEK
FT                   IIVLVQGQKIAQGTPDEVRNNPAVIEAYLGVDEDAHG"
FT                   /protein_id="YP_004125028.1"
     MTALLKVDGL SRYFGGLAAV KDLSFELNAG EIVGLIGPNG AGKSTAFNVI SGSLAPSAGR        60
     IQFAGQSIEG MRPSQVVRHG LARTFQSATV YPAATVQENL YRGALARFDV PVWAQIAQTA       120
     SYRSALRKVR EEVDEVLEIT GLAPYRDDVA GALAYGHQKR IGVAIGLATR PRLLLLDEPA       180
     AGLNPEECAE FGCLLKTLRD RHEISLLFVE HHMALVMNTC EKIIVLVQGQ KIAQGTPDEV       240
     RNNPAVIEAY LGVDEDAHG                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page