(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE354

ALDEN1_2.PE354       Location/Qualifiers
FT   CDS             391433..392146
FT                   /locus_tag="Alide_0364"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="abc transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: oan:Oant_4420 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:319761092"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:10102387"
FT                   /translation="MPTVEVKDVVVHYGLVEALHGVSFTVPAGQIVALVGSNGAGKSTT
FT                   LKALMGLKKVSAGSIHMDGRRIDATGPAQRVSMGLALSPEGRRLFPRMTVWENLMVGAH
FT                   TVGSAAARNRSLEQVCALFPRVQERRSQLAGSLSGGEQQMVAIGRALMSHPQILMLDEP
FT                   SLGIAPKIVSEIAQAIVRLNRETGISVILVEQNARLALKMAHHAYVFEQGTVIRSGSGQ
FT                   ELLRDAFVQKAFLGV"
FT                   /protein_id="YP_004125029.1"
     MPTVEVKDVV VHYGLVEALH GVSFTVPAGQ IVALVGSNGA GKSTTLKALM GLKKVSAGSI        60
     HMDGRRIDAT GPAQRVSMGL ALSPEGRRLF PRMTVWENLM VGAHTVGSAA ARNRSLEQVC       120
     ALFPRVQERR SQLAGSLSGG EQQMVAIGRA LMSHPQILML DEPSLGIAPK IVSEIAQAIV       180
     RLNRETGISV ILVEQNARLA LKMAHHAYVF EQGTVIRSGS GQELLRDAFV QKAFLGV          237
//

If you have problems or comments...

PBIL Back to PBIL home page