(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE355

ALDEN1_2.PE355       Location/Qualifiers
FT   CDS             392149..393171
FT                   /locus_tag="Alide_0365"
FT                   /gene_family="HOG000217475" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /codon_start="1"
FT                   /product="amidohydrolase 2"
FT                   /transl_table="11"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bbr:BB2353
FT                   hypothetical protein"
FT                   /db_xref="GI:319761093"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="GeneID:10102388"
FT                   /translation="MENLPIVPRAEVRPQWLARHHEAPLEPELPIIDPHHHLSDSLWGG
FT                   YLQDDLLADLGAGHNIQSTVFIQVGFGYREDGPGHLRPVGETERVAAIAGRIPAEAGTQ
FT                   VCEGIVGFADLALGARVEETLAAHLQAAAGRFRGIRCHAAAHAQFQYGVMHAPPLHLYM
FT                   DPKFREGYATLARFGLTFDSWAYHTQLDELCDLARAFPDIPVVIDHIGVPLGVGPYVGQ
FT                   RDAVFAEWKRLLQKIAALPNVCIKLGGLGMSVFGFGFHLAGRPPTSEELAQAWSPYILT
FT                   CIEIFGPSRCMFESNFPVDKGTCSYPVLWNTFKRITAGMSEDEKRQLYRDTAARFYRLA
FT                   "
FT                   /protein_id="YP_004125030.1"
     MENLPIVPRA EVRPQWLARH HEAPLEPELP IIDPHHHLSD SLWGGYLQDD LLADLGAGHN        60
     IQSTVFIQVG FGYREDGPGH LRPVGETERV AAIAGRIPAE AGTQVCEGIV GFADLALGAR       120
     VEETLAAHLQ AAAGRFRGIR CHAAAHAQFQ YGVMHAPPLH LYMDPKFREG YATLARFGLT       180
     FDSWAYHTQL DELCDLARAF PDIPVVIDHI GVPLGVGPYV GQRDAVFAEW KRLLQKIAAL       240
     PNVCIKLGGL GMSVFGFGFH LAGRPPTSEE LAQAWSPYIL TCIEIFGPSR CMFESNFPVD       300
     KGTCSYPVLW NTFKRITAGM SEDEKRQLYR DTAARFYRLA                             340
//

If you have problems or comments...

PBIL Back to PBIL home page