(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE356

ALDEN1_2.PE356       Location/Qualifiers
FT   CDS             complement(393156..393887)
FT                   /locus_tag="Alide_0366"
FT                   /gene_family="HOG000229497" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="regulatory protein gntr hth"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0229 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:319761094"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:10102389"
FT                   /translation="MRCANVGTFFLACPMPSNTLPEPAADVPESAADTVFHGIVQGLAQ
FT                   QRFVPGQRLVEVDLAAQFGVSRASVREALQRLAAEGLVDLFRNKGAAIRTLSARETLEV
FT                   LDVAERMTGLLARSAARAVAAGAPRAPIEDALARLHEADRGQGQETFASARRALYRALL
FT                   ATSGSRELRRLLPTIHMPIVYAQHRPAALQRIRMRDYRAMCEAVLQGDEDAADAAGMQH
FT                   VRNVREAIEAAIASDLGQARR"
FT                   /protein_id="YP_004125031.1"
     MRCANVGTFF LACPMPSNTL PEPAADVPES AADTVFHGIV QGLAQQRFVP GQRLVEVDLA        60
     AQFGVSRASV REALQRLAAE GLVDLFRNKG AAIRTLSARE TLEVLDVAER MTGLLARSAA       120
     RAVAAGAPRA PIEDALARLH EADRGQGQET FASARRALYR ALLATSGSRE LRRLLPTIHM       180
     PIVYAQHRPA ALQRIRMRDY RAMCEAVLQG DEDAADAAGM QHVRNVREAI EAAIASDLGQ       240
     ARR                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page