(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE357

ALDEN1_2.PE357       Location/Qualifiers
FT   CDS             393971..395173
FT                   /locus_tag="Alide_0367"
FT                   /gene_family="HOG000131660" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /codon_start="1"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ajs:Ajs_0230 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="GI:319761095"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="GeneID:10102390"
FT                   /translation="MDFSLSPELRALRDKTRRFIAEQVIPLESDPRQSHHGPDESLRRE
FT                   LVARARAAGLLTPHASREMGGLGLSHVEKAVVFEEAGYSRLGPTALNIHAPDEGNIHLM
FT                   EEVATPAQKERWLRPQVAGELRSCFAMTEPSPGAGADPSMLQATAVRDGGDYVINGRKW
FT                   FITGADGADYAIVMARMEDGSATMFLTDMDRPGIVLESNMDAMDACFTGGHGVLRFENL
FT                   RVPAADVLGEIGKGFRYAQVRLAPARLTHCMRWLGQARRAHDTALDYVRRRHAFGKPLV
FT                   EHEGVGFMVADNDMDLHTARLHIWHTAWLLDQGEKCNFESSRAKVVCSEAEWRVVDRSV
FT                   QMLGGQGVTGETPVMRIFTDMRAFRIYDGPSEVHRWSMARKLAHLSEKAEAELLREGGA
FT                   A"
FT                   /protein_id="YP_004125032.1"
     MDFSLSPELR ALRDKTRRFI AEQVIPLESD PRQSHHGPDE SLRRELVARA RAAGLLTPHA        60
     SREMGGLGLS HVEKAVVFEE AGYSRLGPTA LNIHAPDEGN IHLMEEVATP AQKERWLRPQ       120
     VAGELRSCFA MTEPSPGAGA DPSMLQATAV RDGGDYVING RKWFITGADG ADYAIVMARM       180
     EDGSATMFLT DMDRPGIVLE SNMDAMDACF TGGHGVLRFE NLRVPAADVL GEIGKGFRYA       240
     QVRLAPARLT HCMRWLGQAR RAHDTALDYV RRRHAFGKPL VEHEGVGFMV ADNDMDLHTA       300
     RLHIWHTAWL LDQGEKCNFE SSRAKVVCSE AEWRVVDRSV QMLGGQGVTG ETPVMRIFTD       360
     MRAFRIYDGP SEVHRWSMAR KLAHLSEKAE AELLREGGAA                             400
//

If you have problems or comments...

PBIL Back to PBIL home page