(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE358

ALDEN1_2.PE358       Location/Qualifiers
FT   CDS             395170..395943
FT                   /locus_tag="Alide_0368"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase sdr"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dia:Dtpsy_0225 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:319761096"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="GeneID:10102391"
FT                   /translation="MTAAMDRFSLRGRLALVTGASSGLGTHFAQVLAAAGARVAVAARR
FT                   VDKLQGVVDAIAAEGGEARAFALDVADSASVRACFDALCAWGVPDVVVNNAGVTVTRPA
FT                   LEQTEEDFDHVLGTNLKGNWLVATEAARRMVAAGKGGAIVNVASILGERVAGGVAPYAI
FT                   SKAGVVQATKALALELARHGIRVNALLPGYVVTDLNRGFLTSPAGEKLRARIPSRRFGE
FT                   VTDLDGPLLLLASDAGAAMSGATLAVDGAHLVSSL"
FT                   /protein_id="YP_004125033.1"
     MTAAMDRFSL RGRLALVTGA SSGLGTHFAQ VLAAAGARVA VAARRVDKLQ GVVDAIAAEG        60
     GEARAFALDV ADSASVRACF DALCAWGVPD VVVNNAGVTV TRPALEQTEE DFDHVLGTNL       120
     KGNWLVATEA ARRMVAAGKG GAIVNVASIL GERVAGGVAP YAISKAGVVQ ATKALALELA       180
     RHGIRVNALL PGYVVTDLNR GFLTSPAGEK LRARIPSRRF GEVTDLDGPL LLLASDAGAA       240
     MSGATLAVDG AHLVSSL                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page