(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE359

ALDEN1_2.PE359       Location/Qualifiers
FT   CDS             395940..396980
FT                   /locus_tag="Alide_0369"
FT                   /gene_family="HOG000131666" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /codon_start="1"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   ajs:Ajs_0232 aminoglycoside phosphotransferase"
FT                   /db_xref="GI:319761097"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="GeneID:10102392"
FT                   /translation="MSGPANPLPVEALADYLRAQGLAGSAPLQVRVLAGGQSNPTYRVT
FT                   AGAGRDYVLRKKPPGTLIASAHAIDREYRVMKALADTGVPVPRMLHYCESGELLGTPFY
FT                   VMEYLAGRVLMDQSLPGMEPAERHAIYREMNRVIAALHAVDYRAVGLGDYGKEGNYVGR
FT                   QIARWSRQCRESTVPMNEAMHCLMDWLPEHLPSGDETTLVHGDYRLDNLVFHPTEPRVI
FT                   GVLDWELSTLGHPLADLAYQCMAWRIPPSLWRGIAGLDLPALGIPQEAEYIAWYGAATG
FT                   RDAAGHWDYYLAYNLFRMAAILHGIAQRAADGNAAAEDAVETGAKAGPLAELGWQAAQR
FT                   YTATRK"
FT                   /protein_id="YP_004125034.1"
     MSGPANPLPV EALADYLRAQ GLAGSAPLQV RVLAGGQSNP TYRVTAGAGR DYVLRKKPPG        60
     TLIASAHAID REYRVMKALA DTGVPVPRML HYCESGELLG TPFYVMEYLA GRVLMDQSLP       120
     GMEPAERHAI YREMNRVIAA LHAVDYRAVG LGDYGKEGNY VGRQIARWSR QCRESTVPMN       180
     EAMHCLMDWL PEHLPSGDET TLVHGDYRLD NLVFHPTEPR VIGVLDWELS TLGHPLADLA       240
     YQCMAWRIPP SLWRGIAGLD LPALGIPQEA EYIAWYGAAT GRDAAGHWDY YLAYNLFRMA       300
     AILHGIAQRA ADGNAAAEDA VETGAKAGPL AELGWQAAQR YTATRK                      346
//

If you have problems or comments...

PBIL Back to PBIL home page