(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE38

ALDEN1_2.PE38        Location/Qualifiers
FT   CDS             47011..48660
FT                   /locus_tag="Alide_0038"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0020 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="GI:319760776"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="GeneID:10102061"
FT                   /translation="MTMYALMRWFSIRMRMIGAIGVVLTLLFMLGGAGMLGMFRLHGLS
FT                   QDFIAQPHAAVRLLGELRGEMGQIRQAEKDMIIHYERPEAVRAAHTQWLTALDRAKAVA
FT                   TRIDGLNLEQEQALARDIAKHLDTYREQFAHVARQLEEGGYDTATIANRMSTKAVAQFV
FT                   VAAEKLQALDKALGAEVDGAIARQGSIAGQTQWLFGLAVLITVAVVVPFTLLNMVSICR
FT                   PLEAARALAQSIAGGNLAQRIEVDGRDEVADLQRALLDMQGGLGALVSQVRDASGNIAT
FT                   ASQEIAMGNQDLSARTEQTASNAQEAVAALSQLTATVQQTASSSQVANQLVASASGTAT
FT                   RGGQVVQQAVSSMHEISASSRKIGDIIGLIDSIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAGEVRNLAQRSAAAASEIKGLIQSSVQAVEGGVRHVEDAGKAMQEIVVSVQRVTDMI
FT                   GEIHSAATEQAAGIGEVNASVGEIDRMTQQNAALVEESAAAAESLREQAARLSQVVQQF
FT                   QLADGQQAAARAAAPARAALESDPALPRLGVA"
FT                   /protein_id="YP_004124713.1"
     MTMYALMRWF SIRMRMIGAI GVVLTLLFML GGAGMLGMFR LHGLSQDFIA QPHAAVRLLG        60
     ELRGEMGQIR QAEKDMIIHY ERPEAVRAAH TQWLTALDRA KAVATRIDGL NLEQEQALAR       120
     DIAKHLDTYR EQFAHVARQL EEGGYDTATI ANRMSTKAVA QFVVAAEKLQ ALDKALGAEV       180
     DGAIARQGSI AGQTQWLFGL AVLITVAVVV PFTLLNMVSI CRPLEAARAL AQSIAGGNLA       240
     QRIEVDGRDE VADLQRALLD MQGGLGALVS QVRDASGNIA TASQEIAMGN QDLSARTEQT       300
     ASNAQEAVAA LSQLTATVQQ TASSSQVANQ LVASASGTAT RGGQVVQQAV SSMHEISASS       360
     RKIGDIIGLI DSIAFQTNIL ALNAAVEAAR AGEQGRGFAV VAGEVRNLAQ RSAAAASEIK       420
     GLIQSSVQAV EGGVRHVEDA GKAMQEIVVS VQRVTDMIGE IHSAATEQAA GIGEVNASVG       480
     EIDRMTQQNA ALVEESAAAA ESLREQAARL SQVVQQFQLA DGQQAAARAA APARAALESD       540
     PALPRLGVA                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page