(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE41

ALDEN1_2.PE41        Location/Qualifiers
FT   CDS             complement(53193..54434)
FT                   /locus_tag="Alide_0041"
FT                   /gene_family="HOG000224881" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /codon_start="1"
FT                   /product="outer membrane efflux protein"
FT                   /transl_table="11"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   aav:Aave_0040 outer membrane efflux protein"
FT                   /db_xref="GI:319760779"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="GeneID:10102064"
FT                   /translation="MGQAPAGWAQTPPAASGTPTLTLAQALAAARDNSDVALARHALAG
FT                   ARADVLAADHAPAPVLSTKAASIDLQNGVGGGNVVTRKRIDKSIGIDWTWERGDKRALR
FT                   TLAAQRALDAAQSDVQDMQTQQLQAALSAYYDLLAAQERLRETREIERGMAELDRVANL
FT                   RLKAGDLARQDAARTRIESERARSDSELAELARTQAAVALAQLTARGPGLQACACDWPA
FT                   QVAGPAPGGDLLTWAESRADVRAALARVQAAQAELDSAMALRKADVTIGASYDHYPGTS
FT                   NRLVELRAQIPLQWGYRFEGEIGRAQAMLSAAQEALDKTRRLALLDLQSLQQQAASAAQ
FT                   RAAGYENGILPRAREVAQSAELAYAKGAIPLTDLLDARRTLRATALEALAARADYAKAQ
FT                   GNWLLRTEPQLLLP"
FT                   /protein_id="YP_004124716.1"
     MGQAPAGWAQ TPPAASGTPT LTLAQALAAA RDNSDVALAR HALAGARADV LAADHAPAPV        60
     LSTKAASIDL QNGVGGGNVV TRKRIDKSIG IDWTWERGDK RALRTLAAQR ALDAAQSDVQ       120
     DMQTQQLQAA LSAYYDLLAA QERLRETREI ERGMAELDRV ANLRLKAGDL ARQDAARTRI       180
     ESERARSDSE LAELARTQAA VALAQLTARG PGLQACACDW PAQVAGPAPG GDLLTWAESR       240
     ADVRAALARV QAAQAELDSA MALRKADVTI GASYDHYPGT SNRLVELRAQ IPLQWGYRFE       300
     GEIGRAQAML SAAQEALDKT RRLALLDLQS LQQQAASAAQ RAAGYENGIL PRAREVAQSA       360
     ELAYAKGAIP LTDLLDARRT LRATALEALA ARADYAKAQG NWLLRTEPQL LLP              413
//

If you have problems or comments...

PBIL Back to PBIL home page