(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE46

ALDEN1_2.PE46        Location/Qualifiers
FT   CDS             complement(58561..58857)
FT                   /locus_tag="Alide_0046"
FT                   /gene_family="HOG000257225" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dia:Dtpsy_0043 protein of unknown function UPF0153"
FT                   /db_xref="GI:319760784"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="GeneID:10102069"
FT                   /translation="MDYRPGCGACCSAPSISSPIPGRPGGKPAGVRCVQLDDDARCRIF
FT                   GHPGRPPVCASLQPHPAMCGGSRQEAESILSRLERLTQPGAPYTSAAKAMRKA"
FT                   /protein_id="YP_004124721.1"
     MDYRPGCGAC CSAPSISSPI PGRPGGKPAG VRCVQLDDDA RCRIFGHPGR PPVCASLQPH        60
     PAMCGGSRQE AESILSRLER LTQPGAPYTS AAKAMRKA                                98
//

If you have problems or comments...

PBIL Back to PBIL home page