(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE48

ALDEN1_2.PE48        Location/Qualifiers
FT   CDS             59574..61553
FT                   /locus_tag="Alide_0048"
FT                   /gene_family="HOG000201060" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /codon_start="1"
FT                   /product="glucose inhibited division protein a"
FT                   /transl_table="11"
FT                   /note="manually curated; TIGRFAM: glucose inhibited
FT                   division protein A; KEGG: dia:Dtpsy_0045 tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA; PFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="GI:319760786"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="GeneID:10102071"
FT                   /translation="MLYPQEFDVIVVGGGHAGTEAALAAARMGCRTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRRMLENQPNLWLFQQAVDDLMVEGDRVAGAVTQIGLRFRARAVVLTAGTFLDGRI
FT                   HVGLNNYAAGRAGDPPAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSQCEEQPGDG
FT                   MPGGVNEGVLPVFSFMGSTVMHPRQVPCWITHTNARTHEIIRSGFDRSPMFTGKIEGVG
FT                   PRYCPSVEDKINRFADKESHQIFLEPEGLTTHEFYPNGISTSLPFDIQYALVRSMRGLE
FT                   NAHILRPGYAIEYDYFDPRSLKSSFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGLNA
FT                   ALQCRGEAPWLPRRDEAYLGVLVDDLVTKGVTEPYRMFTSRAEFRLQLREDNADMRLTE
FT                   AGRRMGLVDDARWDAFAAKRDAVSRETERLKSTWVNPRILAAAEAERVLGKAIDHEYNL
FT                   FDLLRRPDVDYARLMSLDGGKYASGDVSRETLGALSEPVIEQVEIAAKYAGYIDRQKDE
FT                   VQRAAHYEQLRLPPELDYMQVSALSIEVRQKLQKHRPETLGQASRISGVTPAAISLLLV
FT                   HLKKGGFKGFAQPAPTGEGHVVSA"
FT                   /protein_id="YP_004124723.1"
     MLYPQEFDVI VVGGGHAGTE AALAAARMGC RTLLLTHNIE TLGQMSCNPS IGGIGKGHLV        60
     KEVDALGGAM ALATDEGGIQ FRILNSSKGP AVRATRAQAD RILYKAAIRR MLENQPNLWL       120
     FQQAVDDLMV EGDRVAGAVT QIGLRFRARA VVLTAGTFLD GRIHVGLNNY AAGRAGDPPA       180
     VSLSARLKEL KLPQGRLKTG TPPRIDGRSI DFSQCEEQPG DGMPGGVNEG VLPVFSFMGS       240
     TVMHPRQVPC WITHTNARTH EIIRSGFDRS PMFTGKIEGV GPRYCPSVED KINRFADKES       300
     HQIFLEPEGL TTHEFYPNGI STSLPFDIQY ALVRSMRGLE NAHILRPGYA IEYDYFDPRS       360
     LKSSFETRQI QGLFFAGQIN GTTGYEEAAA QGLFAGLNAA LQCRGEAPWL PRRDEAYLGV       420
     LVDDLVTKGV TEPYRMFTSR AEFRLQLRED NADMRLTEAG RRMGLVDDAR WDAFAAKRDA       480
     VSRETERLKS TWVNPRILAA AEAERVLGKA IDHEYNLFDL LRRPDVDYAR LMSLDGGKYA       540
     SGDVSRETLG ALSEPVIEQV EIAAKYAGYI DRQKDEVQRA AHYEQLRLPP ELDYMQVSAL       600
     SIEVRQKLQK HRPETLGQAS RISGVTPAAI SLLLVHLKKG GFKGFAQPAP TGEGHVVSA        659
//

If you have problems or comments...

PBIL Back to PBIL home page