(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE5

ALDEN1_2.PE5         Location/Qualifiers
FT   CDS             complement(6074..7267)
FT                   /locus_tag="Alide_0005"
FT                   /gene_family="HOG000219745" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /codon_start="1"
FT                   /product="l-carnitine dehydratase/bile acid-inducible
FT                   protein f"
FT                   /transl_table="11"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: reh:H16_A2137 acyl-CoA
FT                   transferase/carnitine dehydratase"
FT                   /db_xref="GI:319760743"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="GeneID:10102028"
FT                   /translation="MASLDGLKVVDLSRVLGGPLCAQILGDHGADVVKVEGPAGDETRT
FT                   WGPPFNDAGMASYFAGINRNKRTVCVDLSEPEGRDVVMRLLQDADVLVENFKVGTLERW
FT                   GMGYDEVLRERFPRLIHCRVTGFGATGPLGGLPGYDAAVQALSGLMSINGDPDGVATRM
FT                   GVPIVDVTTGLNAVIGILMALHERERSGRGQSVESALFDSALFSLYPHSINTLFTGRAP
FT                   QRSGNGHPNIAPYDTYATATEPIYLAVGNNGQFQRLCEAVGHAHLAEDERYATNAQRAV
FT                   HRFELKKDLQSAFSSFDAQTLFRKLVAVGVPCGVIQNVVEALAHPHTAHRGMVAEVEGF
FT                   RSVASPIKFSRTPASYRLRPQEIGQSTLQVLGEAGLSQEQITLLLERGVIRQAPRPE"
FT                   /protein_id="YP_004124680.1"
     MASLDGLKVV DLSRVLGGPL CAQILGDHGA DVVKVEGPAG DETRTWGPPF NDAGMASYFA        60
     GINRNKRTVC VDLSEPEGRD VVMRLLQDAD VLVENFKVGT LERWGMGYDE VLRERFPRLI       120
     HCRVTGFGAT GPLGGLPGYD AAVQALSGLM SINGDPDGVA TRMGVPIVDV TTGLNAVIGI       180
     LMALHERERS GRGQSVESAL FDSALFSLYP HSINTLFTGR APQRSGNGHP NIAPYDTYAT       240
     ATEPIYLAVG NNGQFQRLCE AVGHAHLAED ERYATNAQRA VHRFELKKDL QSAFSSFDAQ       300
     TLFRKLVAVG VPCGVIQNVV EALAHPHTAH RGMVAEVEGF RSVASPIKFS RTPASYRLRP       360
     QEIGQSTLQV LGEAGLSQEQ ITLLLERGVI RQAPRPE                                397
//

If you have problems or comments...

PBIL Back to PBIL home page