(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE50

ALDEN1_2.PE50        Location/Qualifiers
FT   CDS             61769..62416
FT                   /locus_tag="Alide_0050"
FT                   /gene_family="HOG000221012" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /codon_start="1"
FT                   /product="methyltransferase gidb"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0046 16S rRNA methyltransferase
FT                   GidB; TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein"
FT                   /db_xref="GI:319760788"
FT                   /db_xref="GO:0008649"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="GeneID:10102073"
FT                   /translation="MVDAAPLRQGVQALGLDLTEEQIARLLDFLALLQKWNKVYNLTAV
FT                   RDPQEMLTHHLLDSLAAVAPLRRHLAQQGGAGRRLLDVGSGGGLPGVVFAICCPDLDVS
FT                   CVDTVAKKAAFIQQAAAALGLRNLHGIHARVETLAGPFDVVSCRAFASLPDFVNWSRQV
FT                   LAPHAVWLAMKGRHPQDEIAALPVGVQVFHVEQLAVPGLDAERCIVWMRPVA"
FT                   /protein_id="YP_004124725.1"
     MVDAAPLRQG VQALGLDLTE EQIARLLDFL ALLQKWNKVY NLTAVRDPQE MLTHHLLDSL        60
     AAVAPLRRHL AQQGGAGRRL LDVGSGGGLP GVVFAICCPD LDVSCVDTVA KKAAFIQQAA       120
     AALGLRNLHG IHARVETLAG PFDVVSCRAF ASLPDFVNWS RQVLAPHAVW LAMKGRHPQD       180
     EIAALPVGVQ VFHVEQLAVP GLDAERCIVW MRPVA                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page