(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE52

ALDEN1_2.PE52        Location/Qualifiers
FT   CDS             63076..63846
FT                   /locus_tag="Alide_0052"
FT                   /gene_family="HOG000019422" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0048"
FT                   /codon_start="1"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: dia:Dtpsy_0048 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="GI:319760790"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="GeneID:10102075"
FT                   /translation="MAKIFCIANQKGGVGKTTTSVNLAAGLAKIGQRVLLVDLDPQGNA
FT                   TMGSGVDKRQLALSVYDVLLESSSIKEAAVPAEQCGYHVLGANRELAGAEVELVALEHR
FT                   ERRLKAALAEVDQDYDFVLIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTDLVN
FT                   TIKQVHANLNRDLQIIGLLRVMFDPRITLQSQVSAQLKDHFGDKVFDTVIPRNVRLAEA
FT                   PSYGLPGVVFDPVAKGSQAFVDFAREMVQRIQRM"
FT                   /protein_id="YP_004124727.1"
     MAKIFCIANQ KGGVGKTTTS VNLAAGLAKI GQRVLLVDLD PQGNATMGSG VDKRQLALSV        60
     YDVLLESSSI KEAAVPAEQC GYHVLGANRE LAGAEVELVA LEHRERRLKA ALAEVDQDYD       120
     FVLIDCPPSL SMLTLNGLCS AHGVIVPMQC EYFALEGLTD LVNTIKQVHA NLNRDLQIIG       180
     LLRVMFDPRI TLQSQVSAQL KDHFGDKVFD TVIPRNVRLA EAPSYGLPGV VFDPVAKGSQ       240
     AFVDFAREMV QRIQRM                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page