(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE54

ALDEN1_2.PE54        Location/Qualifiers
FT   CDS             64479..65396
FT                   /locus_tag="Alide_0054"
FT                   /gene_family="HOG000088074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /codon_start="1"
FT                   /product="parb-like partition protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: aav:Aave_0056 chromosome
FT                   segregation DNA-binding protein; SMART: ParB domain protein
FT                   nuclease"
FT                   /db_xref="GI:319760792"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="GeneID:10102077"
FT                   /translation="MVTKKPKGLGRGLEALLGPKVADKAEQAQAEAQGLPSTLALDQLV
FT                   PGVYQPRTRMDEGALYELAESIRAQGVMQPILVRRLGNGENVGKYEIIAGERRFRASRL
FT                   AGLNEVPVLVRDVPDEAAAAMALIENIQREDLNPLEEAQGLQRLIREFGLTHEQAAQAV
FT                   GRSRSAASNLLRLLNLAEPVQTMLMAGDIDMGHARALLALDRATQITAGNQIAARKLSV
FT                   REAEGLVKKLGAEFNLTPQKPKKDKSRDMKRIEEELSDLLMAEVEVRVKKRVKRGSRTE
FT                   EMGELAIAFGSLEALNGLIERLRG"
FT                   /protein_id="YP_004124729.1"
     MVTKKPKGLG RGLEALLGPK VADKAEQAQA EAQGLPSTLA LDQLVPGVYQ PRTRMDEGAL        60
     YELAESIRAQ GVMQPILVRR LGNGENVGKY EIIAGERRFR ASRLAGLNEV PVLVRDVPDE       120
     AAAAMALIEN IQREDLNPLE EAQGLQRLIR EFGLTHEQAA QAVGRSRSAA SNLLRLLNLA       180
     EPVQTMLMAG DIDMGHARAL LALDRATQIT AGNQIAARKL SVREAEGLVK KLGAEFNLTP       240
     QKPKKDKSRD MKRIEEELSD LLMAEVEVRV KKRVKRGSRT EEMGELAIAF GSLEALNGLI       300
     ERLRG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page