(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE55

ALDEN1_2.PE55        Location/Qualifiers
FT   CDS             65421..66200
FT                   /locus_tag="Alide_0055"
FT                   /gene_family="HOG000224884" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Ajs_0032"
FT                   /codon_start="1"
FT                   /product="methyltransferase type 12"
FT                   /transl_table="11"
FT                   /note="KEGG: ajs:Ajs_0032 methyltransferase type 12"
FT                   /db_xref="GI:319760793"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="GeneID:10102078"
FT                   /translation="MRLSWPLPALLAWGVAWLLHAVLQPRLGTLASLLGATGVGVLASL
FT                   WGQNWWRRALIALGFPLSLALTGAAGLPAWAWLLPLAVLLLVYPLNAWRDAPLFPTPRG
FT                   ALHGLDALAPLPSGAAVLDAGCGLGDGLLALRAAYPRARLHGLEWSWPLALLCRLRCPW
FT                   AHVRRGDIWAAGWGDYQLVYVFQRPESMARAAAKALAEMAPGSWLVSLAFEVPGLAACA
FT                   RLPGFAGQGVWIYRMGASAAAPRGATKECEASADVTL"
FT                   /protein_id="YP_004124730.1"
     MRLSWPLPAL LAWGVAWLLH AVLQPRLGTL ASLLGATGVG VLASLWGQNW WRRALIALGF        60
     PLSLALTGAA GLPAWAWLLP LAVLLLVYPL NAWRDAPLFP TPRGALHGLD ALAPLPSGAA       120
     VLDAGCGLGD GLLALRAAYP RARLHGLEWS WPLALLCRLR CPWAHVRRGD IWAAGWGDYQ       180
     LVYVFQRPES MARAAAKALA EMAPGSWLVS LAFEVPGLAA CARLPGFAGQ GVWIYRMGAS       240
     AAAPRGATKE CEASADVTL                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page