(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE56

ALDEN1_2.PE56        Location/Qualifiers
FT   CDS             66260..67300
FT                   /locus_tag="Alide_0056"
FT                   /gene_family="HOG000123847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /codon_start="1"
FT                   /product="peptidoglycan-binding domain 1 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   dia:Dtpsy_0052 peptidoglycan-binding domain 1 protein"
FT                   /db_xref="GI:319760794"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="GeneID:10102079"
FT                   /translation="MSRKTLSLLAAACTVVALAGCETTNMKMGSQDAKTVATGAAAGGS
FT                   AANESSQLERCQSPLGTVSLVENQDAGWYTILRNEYKLPPTANLLRLLIQQSNCFVVVE
FT                   RGAAGMRAMDRERQLMGSGEMRGGSNFGKGQMVASDYGLSPEIIFSNNDAGGVGGALGG
FT                   LIGGGRGRALAAIGGSLKTREASAMLTLVDNRSGVQVAASEGSASKSDFAGFGGIFGGS
FT                   AGGGLGGYQNTAQGKVITAAFMDAYNQMVVALRNYKAQSVQGQGLGGGGKLGVDGGAAP
FT                   SQTKAGAAMSVREAQERLNALGYNVGTPDGSAGPKTARALREFQQQQGLPVTGRLDAAT
FT                   AGALSR"
FT                   /protein_id="YP_004124731.1"
     MSRKTLSLLA AACTVVALAG CETTNMKMGS QDAKTVATGA AAGGSAANES SQLERCQSPL        60
     GTVSLVENQD AGWYTILRNE YKLPPTANLL RLLIQQSNCF VVVERGAAGM RAMDRERQLM       120
     GSGEMRGGSN FGKGQMVASD YGLSPEIIFS NNDAGGVGGA LGGLIGGGRG RALAAIGGSL       180
     KTREASAMLT LVDNRSGVQV AASEGSASKS DFAGFGGIFG GSAGGGLGGY QNTAQGKVIT       240
     AAFMDAYNQM VVALRNYKAQ SVQGQGLGGG GKLGVDGGAA PSQTKAGAAM SVREAQERLN       300
     ALGYNVGTPD GSAGPKTARA LREFQQQQGL PVTGRLDAAT AGALSR                      346
//

If you have problems or comments...

PBIL Back to PBIL home page