(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE57

ALDEN1_2.PE57        Location/Qualifiers
FT   CDS             complement(67380..68285)
FT                   /locus_tag="Alide_0057"
FT                   /gene_family="HOG000111165" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00342"
FT                   /codon_start="1"
FT                   /product="helix-turn-helix, arac domain protein"
FT                   /transl_table="11"
FT                   /note="SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   dia:Dtpsy_0054 transcriptional regulator, AraC family"
FT                   /db_xref="GI:319760795"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="GeneID:10102080"
FT                   /translation="MPIHAAPPPGHADAQAAPAHAPRAARVLSYVESLTPHLFVPSRAR
FT                   PVRAKHRELRADTQVRPHSHPWAQVAISTTGVLRLTVPDGAYIVPPSRALWIPPGVEHA
FT                   VTMVEDADLRTLYFHQPPGRCGPGVARAQEEPWRQCRVLEVSDLLRALVREMPSEPDDA
FT                   PPLPPELLHRERHLSALILDELRRASSVRLGVDLPRDKRLRHLCEAVIADPTRHETLAD
FT                   WARDTGASPRTVARLFRQELSSTFTQWRQQVILARAVALAAGRRPINQIAAELGYNSPS
FT                   AFSAMVRRTVGLAPGRFLGA"
FT                   /protein_id="YP_004124732.1"
     MPIHAAPPPG HADAQAAPAH APRAARVLSY VESLTPHLFV PSRARPVRAK HRELRADTQV        60
     RPHSHPWAQV AISTTGVLRL TVPDGAYIVP PSRALWIPPG VEHAVTMVED ADLRTLYFHQ       120
     PPGRCGPGVA RAQEEPWRQC RVLEVSDLLR ALVREMPSEP DDAPPLPPEL LHRERHLSAL       180
     ILDELRRASS VRLGVDLPRD KRLRHLCEAV IADPTRHETL ADWARDTGAS PRTVARLFRQ       240
     ELSSTFTQWR QQVILARAVA LAAGRRPINQ IAAELGYNSP SAFSAMVRRT VGLAPGRFLG       300
     A                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page