(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE59

ALDEN1_2.PE59        Location/Qualifiers
FT   CDS             complement(69612..70421)
FT                   /locus_tag="Alide_0059"
FT                   /gene_family="HOG000110051" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /codon_start="1"
FT                   /product="mscs mechanosensitive ion channel"
FT                   /transl_table="11"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   bpy:Bphyt_0752 MscS mechanosensitive ion channel"
FT                   /db_xref="GI:319760797"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="GeneID:10102082"
FT                   /translation="MNTTDIWHFLSTQGTDFAIKLATAIAAWIIGRWLISLAVSLMGKL
FT                   LQRGGKIDTTLAHYLKSITGVLLNIILILAILDIFGVKTTSFAALLAGAGLAIGAAWSG
FT                   MLGNFAAGVFMQVLRPYKVGDFISAGGMVGTVTELGLFATTLTTPDNVMTVVGNGKIFG
FT                   DNIQNFSALPVRRVDCVAKVANSVSPLDAIARLKPVISAIPNVATEPAPDIEILEFTPE
FT                   GPKLCVRPYTHTDHYWQVYFDTNKAIVETFGAAGYPVPETPMAYRNA"
FT                   /protein_id="YP_004124734.1"
     MNTTDIWHFL STQGTDFAIK LATAIAAWII GRWLISLAVS LMGKLLQRGG KIDTTLAHYL        60
     KSITGVLLNI ILILAILDIF GVKTTSFAAL LAGAGLAIGA AWSGMLGNFA AGVFMQVLRP       120
     YKVGDFISAG GMVGTVTELG LFATTLTTPD NVMTVVGNGK IFGDNIQNFS ALPVRRVDCV       180
     AKVANSVSPL DAIARLKPVI SAIPNVATEP APDIEILEFT PEGPKLCVRP YTHTDHYWQV       240
     YFDTNKAIVE TFGAAGYPVP ETPMAYRNA                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page