(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE6

ALDEN1_2.PE6         Location/Qualifiers
FT   CDS             complement(7277..8134)
FT                   /locus_tag="Alide_0006"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reh:H16_A2138 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="GI:319760744"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="GeneID:10102029"
FT                   /translation="MQAEDSEAWVLASRVGPVARIHLNRGDARNPLGVEMVQALSAAVG
FT                   EASGQSGVRVILLTAAGPAFSAGGNLGNLGDRLAATAGPDGRDPIAAGNRRYGEFLTQL
FT                   VNVPQVTVACVQGAAMGGGAGLACAVDIAIGSPEVKFGFPEAAIGLVPGQILPFVAARL
FT                   GLPAARRLVLTGRRIAAAEAHRIGLLDYVAESHQALGALTRQVLESVVATAPQASACTK
FT                   RMLGRLPVAPLQASGALQGYLDEAAELFARQMRSEAMEGVSAAREKRPARWNEAGELSA
FT                   LDLA"
FT                   /protein_id="YP_004124681.1"
     MQAEDSEAWV LASRVGPVAR IHLNRGDARN PLGVEMVQAL SAAVGEASGQ SGVRVILLTA        60
     AGPAFSAGGN LGNLGDRLAA TAGPDGRDPI AAGNRRYGEF LTQLVNVPQV TVACVQGAAM       120
     GGGAGLACAV DIAIGSPEVK FGFPEAAIGL VPGQILPFVA ARLGLPAARR LVLTGRRIAA       180
     AEAHRIGLLD YVAESHQALG ALTRQVLESV VATAPQASAC TKRMLGRLPV APLQASGALQ       240
     GYLDEAAELF ARQMRSEAME GVSAAREKRP ARWNEAGELS ALDLA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page