(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE61

ALDEN1_2.PE61        Location/Qualifiers
FT   CDS             complement(70620..72044)
FT                   /locus_tag="Alide_0061"
FT                   /gene_family="HOG000230995" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /codon_start="1"
FT                   /product="fad linked oxidase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ajs:Ajs_0040 fis family transcriptional regulator"
FT                   /db_xref="GI:319760799"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="GeneID:10102084"
FT                   /translation="MNAPAHAAQLQPRIDPRPVPQALLDALSQRFGAQLSTAQAVREQH
FT                   GRDEGSIQAPPPAAVVFAESTQDVQDAMRLAAQHEVPVIAYGAGSSLEGHLLAVQGGIS
FT                   IDVGRMNKVLSIDADDLTVTVQPGITRKALNEAIKDTGLFFPIDPGADASIGGMAATRA
FT                   SGTNAVRYGTMRENVLALEVVTANGDVIRTGTRAKKSSAGYDLTRLMVGSEGTLGIFTE
FT                   VTVRLYPLPEAVSAAICSFPSIEAAVRTVIQTIQLGVPIARVELIDANSVRMVNAHSRL
FT                   ALREEPMLLMEFHGSAASVQEQAETVQGIASEFGGQAFEWASTPEERTRLWTARHNAYF
FT                   AAVQSRPGCKAISTDTCVPISRLADCLLASVDEADASGIPYFLVGHVGDGNFHFGYLIN
FT                   PAVPEERERAEQLNHRLVARALSMGGTCTGEHGVGVHKMGFLVDETGAGAVDMMRAIKR
FT                   ALDPKNILNPGKIFAL"
FT                   /protein_id="YP_004124736.1"
     MNAPAHAAQL QPRIDPRPVP QALLDALSQR FGAQLSTAQA VREQHGRDEG SIQAPPPAAV        60
     VFAESTQDVQ DAMRLAAQHE VPVIAYGAGS SLEGHLLAVQ GGISIDVGRM NKVLSIDADD       120
     LTVTVQPGIT RKALNEAIKD TGLFFPIDPG ADASIGGMAA TRASGTNAVR YGTMRENVLA       180
     LEVVTANGDV IRTGTRAKKS SAGYDLTRLM VGSEGTLGIF TEVTVRLYPL PEAVSAAICS       240
     FPSIEAAVRT VIQTIQLGVP IARVELIDAN SVRMVNAHSR LALREEPMLL MEFHGSAASV       300
     QEQAETVQGI ASEFGGQAFE WASTPEERTR LWTARHNAYF AAVQSRPGCK AISTDTCVPI       360
     SRLADCLLAS VDEADASGIP YFLVGHVGDG NFHFGYLINP AVPEERERAE QLNHRLVARA       420
     LSMGGTCTGE HGVGVHKMGF LVDETGAGAV DMMRAIKRAL DPKNILNPGK IFAL             474
//

If you have problems or comments...

PBIL Back to PBIL home page