(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE62

ALDEN1_2.PE62        Location/Qualifiers
FT   CDS             complement(72821..73033)
FT                   /locus_tag="Alide_0062"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Shel_23880"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shi:Shel_23880 hypothetical protein"
FT                   /db_xref="GI:319760800"
FT                   /db_xref="GeneID:10102085"
FT                   /translation="MASKRRIRRNACTGKYRYSSAAEAQAAIAGLHRRKGYQGFMQPYR
FT                   CSFCNGYHFGHPPKPKKPSGWGHYR"
FT                   /protein_id="YP_004124737.1"
     MASKRRIRRN ACTGKYRYSS AAEAQAAIAG LHRRKGYQGF MQPYRCSFCN GYHFGHPPKP        60
     KKPSGWGHYR                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page