(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE64

ALDEN1_2.PE64        Location/Qualifiers
FT   CDS             complement(73688..74890)
FT                   /locus_tag="Alide_0064"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04233"
FT                   /codon_start="1"
FT                   /product="head morphogenesis protein spp1 gp7"
FT                   /transl_table="11"
FT                   /note="PFAM: head morphogenesis protein SPP1 gp7; KEGG:
FT                   bpt:Bpet4409 F protein (gpF) (protein GP30)"
FT                   /db_xref="GI:319760802"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="GeneID:10102087"
FT                   /translation="MADLGEAARSTVEGARQQFQEQIDFLRRKLNLPSETWRDIQRAAH
FT                   DRAFVVAGATKADLLHDLRKAVEKAVEGESIADFRKRFSEAVAKHGWTGWTGEGSKAGE
FT                   AWRTRVIYQTNLMTSYAAGRRAQLLDPDLVKRRPFWRYVHNDSVTHPRPHHKRWGDMRL
FT                   TLRHDHPFWDTHFPPNGWGCKCRVVAVAAPGEGDATTPPDGWDETDPATSSPVGIDEGW
FT                   NYAPGARADDDLRSFVQDKLIEYPPAISTALSRDVNRYINAEQLVPDFVREVLQDRQRS
FT                   DPLWLGFVERPDWIAEVTGADTRGYTLLLPAEAPRHVQSSHGFDGAGQRPATPEDFAQV
FT                   EAVFNDPDQMRAGATSRHGNATLVATKAINGEVFRAVWEVLQGRRNRSLSLTSLVIKTS
FT                   K"
FT                   /protein_id="YP_004124739.1"
     MADLGEAARS TVEGARQQFQ EQIDFLRRKL NLPSETWRDI QRAAHDRAFV VAGATKADLL        60
     HDLRKAVEKA VEGESIADFR KRFSEAVAKH GWTGWTGEGS KAGEAWRTRV IYQTNLMTSY       120
     AAGRRAQLLD PDLVKRRPFW RYVHNDSVTH PRPHHKRWGD MRLTLRHDHP FWDTHFPPNG       180
     WGCKCRVVAV AAPGEGDATT PPDGWDETDP ATSSPVGIDE GWNYAPGARA DDDLRSFVQD       240
     KLIEYPPAIS TALSRDVNRY INAEQLVPDF VREVLQDRQR SDPLWLGFVE RPDWIAEVTG       300
     ADTRGYTLLL PAEAPRHVQS SHGFDGAGQR PATPEDFAQV EAVFNDPDQM RAGATSRHGN       360
     ATLVATKAIN GEVFRAVWEV LQGRRNRSLS LTSLVIKTSK                             400
//

If you have problems or comments...

PBIL Back to PBIL home page