(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE65

ALDEN1_2.PE65        Location/Qualifiers
FT   CDS             complement(74883..76379)
FT                   /locus_tag="Alide_0065"
FT                   /gene_family="HOG000070347" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06074"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF935; KEGG:
FT                   rsc:RCFBP_11714 hypothetical protein"
FT                   /db_xref="GI:319760803"
FT                   /db_xref="InterPro:IPR009279"
FT                   /db_xref="GeneID:10102088"
FT                   /translation="MKQGIYVTPTEFVSFGEAKRRTSTLGEEVATRARSMDVAGFSFLL
FT                   PNPDPILKRQGKDMRVYRDLRSDAHVGGCIRRRKASVKKLERRVVAGKAGARAVRRAED
FT                   LFSALNMDRVMNEVLDGVLYGWQPLELMWGYRAGALQPLDVVGKPGEWFTFDNEAQLRF
FT                   RSREHPLHGEALEPRKFLLARQEASYANPYGFADLSMCFWPTVFKRGGLKFWVTFTEKY
FT                   GTPWLVGKQPRGTPGPEVEELLDKLEAMIQDAVAAIPDDSSIDVLEAGDKGASAELYKE
FT                   LLMFCRSEVSIALLGQNQSTEASSTHASAVAGLEVAEAIRDGDARMVEATFNQMLRWVT
FT                   DLNEGENAPAPTVELYEEESVNTKLAERDSNLKSAGVNFTTQYWMRAYKLEKGDIAEQA
FT                   APVAVPGAPGVEFAEGTGPTVPAETLAALTAGASPVVELWLREMRRLVEAHRDPQRLQA
FT                   DLLEAFGDLPTGELAALMAAAFELAELQGRDRAAQEAGHG"
FT                   /protein_id="YP_004124740.1"
     MKQGIYVTPT EFVSFGEAKR RTSTLGEEVA TRARSMDVAG FSFLLPNPDP ILKRQGKDMR        60
     VYRDLRSDAH VGGCIRRRKA SVKKLERRVV AGKAGARAVR RAEDLFSALN MDRVMNEVLD       120
     GVLYGWQPLE LMWGYRAGAL QPLDVVGKPG EWFTFDNEAQ LRFRSREHPL HGEALEPRKF       180
     LLARQEASYA NPYGFADLSM CFWPTVFKRG GLKFWVTFTE KYGTPWLVGK QPRGTPGPEV       240
     EELLDKLEAM IQDAVAAIPD DSSIDVLEAG DKGASAELYK ELLMFCRSEV SIALLGQNQS       300
     TEASSTHASA VAGLEVAEAI RDGDARMVEA TFNQMLRWVT DLNEGENAPA PTVELYEEES       360
     VNTKLAERDS NLKSAGVNFT TQYWMRAYKL EKGDIAEQAA PVAVPGAPGV EFAEGTGPTV       420
     PAETLAALTA GASPVVELWL REMRRLVEAH RDPQRLQADL LEAFGDLPTG ELAALMAAAF       480
     ELAELQGRDR AAQEAGHG                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page