(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE67

ALDEN1_2.PE67        Location/Qualifiers
FT   CDS             complement(77062..77247)
FT                   /locus_tag="Alide_0067"
FT                   /gene_family="HOG000163567" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BPSL1153"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bps:BPSL1153 hypothetical protein"
FT                   /db_xref="GI:319760805"
FT                   /db_xref="GeneID:10102090"
FT                   /translation="MDELDITYALSKQIPDMERGFTISTSYGDLVVEAHEAAAFVEAAN
FT                   LLMFQRLAALRGSKQS"
FT                   /protein_id="YP_004124742.1"
     MDELDITYAL SKQIPDMERG FTISTSYGDL VVEAHEAAAF VEAANLLMFQ RLAALRGSKQ        60
     S                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page