(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE68

ALDEN1_2.PE68        Location/Qualifiers
FT   CDS             complement(77251..77721)
FT                   /locus_tag="Alide_0068"
FT                   /gene_family="HOG000222052" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CV_2153"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cvi:CV_2153 hypothetical protein"
FT                   /db_xref="GI:319760806"
FT                   /db_xref="GeneID:10102091"
FT                   /translation="MIRRDWKRLRASSLVHAMRLCKEYAQAKHNLSVERIADRMGATHD
FT                   TLYKWLATGRMPAILIPAYELACGCHYISDWLAASAGRLVVPMPTGRKAEGTELLDMNS
FT                   SCAAALQLLTAFYQAPTEADTEATLAALRLHLEQVAYHHHNVAQYATPELEF"
FT                   /protein_id="YP_004124743.1"
     MIRRDWKRLR ASSLVHAMRL CKEYAQAKHN LSVERIADRM GATHDTLYKW LATGRMPAIL        60
     IPAYELACGC HYISDWLAAS AGRLVVPMPT GRKAEGTELL DMNSSCAAAL QLLTAFYQAP       120
     TEADTEATLA ALRLHLEQVA YHHHNVAQYA TPELEF                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page