(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE69

ALDEN1_2.PE69        Location/Qualifiers
FT   CDS             77965..78771
FT                   /locus_tag="Alide_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_4097"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_4097 hypothetical protein"
FT                   /db_xref="GI:319760807"
FT                   /db_xref="GeneID:10102092"
FT                   /translation="MQTYRNWRVIWRCWRRRSQSQLGNPGSQSLQGRCCSRMLDHQQIA
FT                   DALGLARRQLRVTAICYPAAIRVIGRTEVYRQIAEVRIDGKVKLTQPIGYAFPAGAVFS
FT                   TALRQGDRFARVSRVYDQQSWDGVTWYDGLDPSKGAATATYDTTNYPIEVNNRGAITER
FT                   WALRFRSGGQVFDFIGQHLGQIASGNVNEDFSPMNIAAGAPYMTIRAGGWGSGWAAGNV
FT                   LFPDTIGAEAPIDCVRCVQPGSPAGIDDRAWIVQRGDVGRDPESDF"
FT                   /protein_id="YP_004124744.1"
     MQTYRNWRVI WRCWRRRSQS QLGNPGSQSL QGRCCSRMLD HQQIADALGL ARRQLRVTAI        60
     CYPAAIRVIG RTEVYRQIAE VRIDGKVKLT QPIGYAFPAG AVFSTALRQG DRFARVSRVY       120
     DQQSWDGVTW YDGLDPSKGA ATATYDTTNY PIEVNNRGAI TERWALRFRS GGQVFDFIGQ       180
     HLGQIASGNV NEDFSPMNIA AGAPYMTIRA GGWGSGWAAG NVLFPDTIGA EAPIDCVRCV       240
     QPGSPAGIDD RAWIVQRGDV GRDPESDF                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page