(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE7

ALDEN1_2.PE7         Location/Qualifiers
FT   CDS             8188..9030
FT                   /locus_tag="Alide_0007"
FT                   /gene_family="HOG000233517" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /codon_start="1"
FT                   /product="lysr substrate-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: reh:H16_A2139 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="GI:319760745"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="GeneID:10102030"
FT                   /translation="MRNLDIGLLRTFVAVAERESFTNAAEKVYRTQAAVSQQMQKLESV
FT                   LGCALFERVGRRKKLTVEGVRLLEYARRMVGLNDEAYRVITQQAATQPVKIGACADAVD
FT                   TLLPAYLEICAENFPNLSIDIQVGRSRWLASALRKGDIDLMLDITPHPEFAHTVLRTSP
FT                   VAWIAGARYHPQAGASVPLILMEAACPFRSSMVQALTEAGIPWHAAFETSTLAGVRAAL
FT                   RAGLGVTARAVEMLAPDLRVLDPQARLPALPPISFCLYWRADASHESAMKVRHLIAPH"
FT                   /protein_id="YP_004124682.1"
     MRNLDIGLLR TFVAVAERES FTNAAEKVYR TQAAVSQQMQ KLESVLGCAL FERVGRRKKL        60
     TVEGVRLLEY ARRMVGLNDE AYRVITQQAA TQPVKIGACA DAVDTLLPAY LEICAENFPN       120
     LSIDIQVGRS RWLASALRKG DIDLMLDITP HPEFAHTVLR TSPVAWIAGA RYHPQAGASV       180
     PLILMEAACP FRSSMVQALT EAGIPWHAAF ETSTLAGVRA ALRAGLGVTA RAVEMLAPDL       240
     RVLDPQARLP ALPPISFCLY WRADASHESA MKVRHLIAPH                             280
//

If you have problems or comments...

PBIL Back to PBIL home page