(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE70

ALDEN1_2.PE70        Location/Qualifiers
FT   CDS             78805..79977
FT                   /locus_tag="Alide_0070"
FT                   /gene_family="HOG000225325" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pnap_2245"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pna:Pnap_2245 hypothetical protein"
FT                   /db_xref="GI:319760808"
FT                   /db_xref="GeneID:10102093"
FT                   /translation="MATYPVKYITNTMRGAPQISGQAGTLQAALRTFLLTGFGLTTALS
FT                   VTVAGGIATASLNEGQTFAQGCVVLVDGGTPAQINGEARVLTSSNSAITWATTAPDGPA
FT                   TGTITIKVAPVGGWEELFPGTPNKSVFRSIDPQASGFCYRVDDSGTTQARVRGFESMTD
FT                   IDTGTGPFPTDTQISGGGYTAKSYSEGATPVSYLLAADSRTVLIAISSYSSILATYTVA
FT                   PIRGFGDMLPLAPDGDPYSAAISCNSNSGTASFGAFGFYRSGAASIYCPRPRGGIGSAV
FT                   RADTYPYVGNAATVSGADPKLGAFPSDVDGELKYCRQYIAAGENLTPRADVPGVLYIPQ
FT                   TGVGALIKSGDTLQGSGALAGRTLRAVGANSSADAEPVGAWLIDVTGPWR"
FT                   /protein_id="YP_004124745.1"
     MATYPVKYIT NTMRGAPQIS GQAGTLQAAL RTFLLTGFGL TTALSVTVAG GIATASLNEG        60
     QTFAQGCVVL VDGGTPAQIN GEARVLTSSN SAITWATTAP DGPATGTITI KVAPVGGWEE       120
     LFPGTPNKSV FRSIDPQASG FCYRVDDSGT TQARVRGFES MTDIDTGTGP FPTDTQISGG       180
     GYTAKSYSEG ATPVSYLLAA DSRTVLIAIS SYSSILATYT VAPIRGFGDM LPLAPDGDPY       240
     SAAISCNSNS GTASFGAFGF YRSGAASIYC PRPRGGIGSA VRADTYPYVG NAATVSGADP       300
     KLGAFPSDVD GELKYCRQYI AAGENLTPRA DVPGVLYIPQ TGVGALIKSG DTLQGSGALA       360
     GRTLRAVGAN SSADAEPVGA WLIDVTGPWR                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page