(data stored in ACNUC7421 zone)

HOGENOMDNA: ALDEN1_2.PE71

ALDEN1_2.PE71        Location/Qualifiers
FT   CDS             79986..80393
FT                   /locus_tag="Alide_0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:sce2651"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce2651 carbohydrate ABC transporter"
FT                   /db_xref="GI:319760809"
FT                   /db_xref="GeneID:10102094"
FT                   /translation="MAALAYIASFVGLAGAVTPSTAPPRFTAATAIGLLSNQGGRNWRF
FT                   FGDTSGTVLNNNRVMVKPSATAPEVPFAGARVRLHRLTDGYCAWEGISDAAGYYWPRGL
FT                   EVGLLYYPVAIDLTGTHECDAAGPVIAVRAP"
FT                   /protein_id="YP_004124746.1"
     MAALAYIASF VGLAGAVTPS TAPPRFTAAT AIGLLSNQGG RNWRFFGDTS GTVLNNNRVM        60
     VKPSATAPEV PFAGARVRLH RLTDGYCAWE GISDAAGYYW PRGLEVGLLY YPVAIDLTGT       120
     HECDAAGPVI AVRAP                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page